DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and CG17242

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001259921.1 Gene:CG17242 / 59226 FlyBaseID:FBgn0250841 Length:245 Species:Drosophila melanogaster


Alignment Length:265 Identity:99/265 - (37%)
Similarity:132/265 - (49%) Gaps:39/265 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCLRLLLSILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAIL 65
            |.|:.:| :|||||.:|...:..|            ||..|||.|||.|..|.|||||||:..||
  Fly     1 MLLKGIL-LLVSIAQIAADFKSIG------------IEQAPWQASVQINDKHHCGGVIYSEDIIL 52

  Fly    66 TAAHCLSNVTVTDLSVRAGSSYWSKGGQVLKV----LKTIAHPKYVPKLYNPYDIAVLILEAPLR 126
            |.|.|:....:..:|||.||:..:.||.||||    |:.:.        ..|.|:|:|.|.:||.
  Fly    53 TIAECVRKARLEFISVRVGSAQENAGGTVLKVEKMRLQVLG--------LRPSDVAILQLRSPLY 109

  Fly   127 LGGTVKKIPLAEQTPVAGTIVLTSGWG-YTRENSSFLWPILQGVHVAILNRTDCLK--AYKHVNI 188
            |.|.::.||||....|.||....|||| .:..|.|.  .:|..|.|.|.::..|..  |.|...:
  Fly   110 LDGGIRAIPLATIPLVPGTNASVSGWGQLSAMNPSS--EVLLRVDVKIQDQLMCATNLALKGRLM 172

  Fly   189 TIDMICA--DGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCG--TNPGVYEDIAFFHNWI 249
            ::..|||  .|:....|||..||||:     .:.:|.|::||...|.  ....||.:||.|..||
  Fly   173 SVGEICAAPAGEIPYACQGFVGGPLV-----ANNRLYGILSWQSACDVLNKSSVYANIAMFKVWI 232

  Fly   250 KYTVK 254
            :.|||
  Fly   233 ESTVK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 84/231 (36%)
Tryp_SPc 29..250 CDD:238113 85/231 (37%)
CG17242NP_001259921.1 Tryp_SPc 24..235 CDD:238113 86/225 (38%)
Tryp_SPc 24..232 CDD:214473 84/222 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.