DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and CG34458

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:252 Identity:88/252 - (34%)
Similarity:129/252 - (51%) Gaps:17/252 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCL 71
            ||||:.......:......|.||:||.:......|.|||:|.|..|.|||.:.||..|:|||||.
  Fly    10 LSILLLAVTFVHSDMDVAEESRIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDTMIVTAAHCT 74

  Fly    72 SNVTVTDLSVRAGSSYWSKG-GQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGTVKKIP 135
            .......:....|::..|.| ||...:.:.|.||:|.|:..: :|::::.|.:|:.:||.|:.|.
  Fly    75 MGQNPGQMKAIVGTNDLSAGNGQTFNIAQFIIHPRYNPQSQD-FDMSLIKLSSPVPMGGAVQTIQ 138

  Fly   136 LAEQTP--VAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHVNITIDMICA--- 195
            ||:...  .|.|:.:.||:|...:|.. |...|:...|.:.:|..| .:.....:|..|:||   
  Fly   139 LADSDSNYAADTMAMISGFGAINQNLQ-LPNRLKFAQVQLWSRDYC-NSQNIPGLTDRMVCAGHP 201

  Fly   196 DGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGT--NPGVYEDIAFFHNWIK 250
            .|| ..:|||||||||  |..|   :|.|:||||.|||.  .|.:|..:....:|||
  Fly   202 SGQ-VSSCQGDSGGPL--TVDG---KLFGVVSWGFGCGAKGRPAMYTYVGALRSWIK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 80/228 (35%)
Tryp_SPc 29..250 CDD:238113 80/228 (35%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 80/228 (35%)
Tryp_SPc 32..254 CDD:238113 82/230 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452424
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104239at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.