DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and TMPRSS4

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_005271670.1 Gene:TMPRSS4 / 56649 HGNCID:11878 Length:494 Species:Homo sapiens


Alignment Length:264 Identity:103/264 - (39%)
Similarity:142/264 - (53%) Gaps:33/264 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCLSNV 74
            |||:..|||...:..|  |:||.....::..|||||:|.:..|.|||.|.....:||||||....
Human   188 LVSLHCLACGKSLKTP--RVVGVEEASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKH 250

  Fly    75 T-VTDLSVRAGSSYWSKGGQ-----VLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGTVKK 133
            | |.:..|||||   .|.|.     |.|::....:|.| ||   ..|||::.|:.||...|||:.
Human   251 TDVFNWKVRAGS---DKLGSFPSLAVAKIIIIEFNPMY-PK---DNDIALMKLQFPLTFSGTVRP 308

  Fly   134 IPL----AEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCL--KAYKHVNITIDM 192
            |.|    .|.||.....::  |||:|::|...:..||....|.:::.|.|.  .||:. .:|..|
Human   309 ICLPFFDEELTPATPLWII--GWGFTKQNGGKMSDILLQASVQVIDSTRCNADDAYQG-EVTEKM 370

  Fly   193 ICA---DGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCG--TNPGVYEDIAFFHNWIKYT 252
            :||   :| ..|||||||||||:..:...|  ::|:||||.|||  :.||||..::.:.||| |.
Human   371 MCAGIPEG-GVDTCQGDSGGPLMYQSDQWH--VVGIVSWGYGCGGPSTPGVYTKVSAYLNWI-YN 431

  Fly   253 VKKN 256
            |.|:
Human   432 VWKD 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 91/237 (38%)
Tryp_SPc 29..250 CDD:238113 91/237 (38%)
TMPRSS4XP_005271670.1 LDLa 58..92 CDD:238060
SRCR_2 108..197 CDD:295335 5/8 (63%)
Tryp_SPc 204..429 CDD:214473 91/237 (38%)
Tryp_SPc 205..432 CDD:238113 93/240 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5417
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.