DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and Klk4

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_064312.1 Gene:Klk4 / 56640 MGIID:1861379 Length:255 Species:Mus musculus


Alignment Length:254 Identity:76/254 - (29%)
Similarity:123/254 - (48%) Gaps:20/254 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCLSN 73
            :::.:.| |.|:.:   ..||:.|........|||.::.:.....|.||:...:.:|:|||||..
Mouse    16 LILEVTG-ASASSV---SSRIIQGQDCSPHSQPWQAALFSEDGFFCSGVLVHPQWVLSAAHCLQE 76

  Fly    74 VTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKY-VPKLYNPYDIAVLILEAPLRLGGTVKKIPLA 137
            ..:..|.:.........|.::|:...:|.||.: .|...|  |:.::.|...:....|::.||:|
Mouse    77 SYIVGLGLHNLKGSQEPGSRMLEAHLSIQHPNFNDPSFAN--DLMLIKLNESVIESNTIRSIPVA 139

  Fly   138 EQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHVNITIDMICADG--QRW 200
            .|.|..|...|.||||..:...  |..:||.|::::.:...|...|..| ..:.|.||.|  .:.
Mouse   140 TQCPTPGDTCLVSGWGQLKNGK--LPSLLQCVNLSVASEETCRLLYDPV-YHLSMFCAGGGQDQK 201

  Fly   201 DTCQGDSGGPLIETTKGGHRQLIGMVSWGDG-CGTN--PGVYEDIAFFHNWIKYTVKKN 256
            |:|.||||||::     .:|.|.|:||.|.| ||..  |.||.::..|.|||:..::.|
Mouse   202 DSCNGDSGGPIV-----CNRSLQGLVSMGQGKCGQPGIPSVYTNLCKFTNWIQTIIQTN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 70/226 (31%)
Tryp_SPc 29..250 CDD:238113 70/226 (31%)
Klk4NP_064312.1 Tryp_SPc 32..251 CDD:238113 71/228 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.