DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and AZU1

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001691.1 Gene:AZU1 / 566 HGNCID:913 Length:251 Species:Homo sapiens


Alignment Length:268 Identity:74/268 - (27%)
Similarity:109/268 - (40%) Gaps:57/268 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSILVSIAGLACAARI-PGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHC 70
            |::|..:|||..::|. ..|...||||........|:..|:||...|.|||.:...|.::|||.|
Human     4 LTVLALLAGLLASSRAGSSPLLDIVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAASC 68

  Fly    71 LSNVTVTDLSVRAGSSYWSKGGQVLK----------VLKTIAHPKYVPKLYNPYDIAVLIL--EA 123
            ..       |...|.|....|...|:          .:.:::...|.|: .|..|:.:|.|  ||
Human    69 FQ-------SQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGYDPQ-QNLNDLMLLQLDREA 125

  Fly   124 PLRLGGTVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHVNI 188
            .|....|:..:||...|..|||....:|||..|....             |:|..     :.||:
Human   126 NLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGR-------------LSRFP-----RFVNV 172

  Fly   189 TI--------DMICAD--GQRWDTCQGDSGGPLIETTKG-GHRQLIGMVSWGDG-CGTNPGVYED 241
            |:        :.:|..  .:|...|.||.|.||:  .:| .|    |:.|:..| ||..|..:..
Human   173 TVTPEDQCRPNNVCTGVLTRRGGICNGDGGTPLV--CEGLAH----GVASFSLGPCGRGPDFFTR 231

  Fly   242 IAFFHNWI 249
            :|.|.:||
Human   232 VALFRDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 65/244 (27%)
Tryp_SPc 29..250 CDD:238113 67/245 (27%)
AZU1NP_001691.1 Tryp_SPc 27..240 CDD:238113 67/245 (27%)
Possesses antibiotic activity. /evidence=ECO:0000269|PubMed:8506327 46..70 10/23 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.