DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and Klk11

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001170844.1 Gene:Klk11 / 56538 MGIID:1929977 Length:276 Species:Mus musculus


Alignment Length:276 Identity:85/276 - (30%)
Similarity:125/276 - (45%) Gaps:47/276 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCLRLLLSILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAIL 65
            |.|||:        .||......|.|.||:.|........||||::...:...||..:.:.:.:|
Mouse    28 MILRLI--------ALALVTGHVGGETRIIKGYECRPHSQPWQVALFQKTRLLCGATLIAPKWLL 84

  Fly    66 TAAHCLS----------NVTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKY---VPKLYNPYDIA 117
            |||||..          |:..||     |..      |.....::..||.:   :|...:..||.
Mouse    85 TAAHCRKPHYVILLGEHNLEKTD-----GCE------QRRMATESFPHPDFNNSLPNKDHRNDIM 138

  Fly   118 VLILEAPLRLGGTVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKA 182
            ::.:.:|:.....|:.:.|:.....|||..|.||||.|......|...|:..:|:|:...:|.||
Mouse   139 LVKMSSPVFFTRAVQPLTLSPHCVAAGTSCLISGWGTTSSPQLRLPHSLRCANVSIIEHKECEKA 203

  Fly   183 YKHVNITIDMICA----DGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWG-DGCGT--NPGVYE 240
            |.. |||..|:||    :|:  |:|||||||||:     .:..|.|::||| |.|..  .||||.
Mouse   204 YPG-NITDTMLCASVRKEGK--DSCQGDSGGPLV-----CNGSLQGIISWGQDPCAVTRKPGVYT 260

  Fly   241 DIAFFHNWIKYTVKKN 256
            .:..:.|||...::.|
Mouse   261 KVCKYFNWIHEVMRNN 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 74/240 (31%)
Tryp_SPc 29..250 CDD:238113 74/240 (31%)
Klk11NP_001170844.1 Tryp_SPc 47..269 CDD:214473 74/240 (31%)
Tryp_SPc 48..272 CDD:238113 75/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.