DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and si:dkey-33m11.8

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_693464.3 Gene:si:dkey-33m11.8 / 565078 ZFINID:ZDB-GENE-141215-49 Length:251 Species:Danio rerio


Alignment Length:267 Identity:89/267 - (33%)
Similarity:136/267 - (50%) Gaps:39/267 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CLRLLLSILVSIAGLACAARIPG-PEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAIL 65
            ||...|.::||:        :.| .::||:||..:....:.:|.|||.|:.|.|||.:...:.::
Zfish     4 CLEYTLLLIVSM--------LQGSKQQRIIGGQEVQPYSIKYQASVQYNNYHYCGGTLIHPQWVV 60

  Fly    66 TAAHC-----LSNVTVT--DLSVRAGSSYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEA 123
            :||||     |..|.::  |||...|..      :|..|.|.:.|..|..:.::. ||.:|.||.
Zfish    61 SAAHCWRPSYLIKVVLSEHDLSKIEGFE------RVFNVSKALVHYMYNYRTFDS-DIMLLKLEK 118

  Fly   124 PLRLGGTVKKIPLAEQTPV--AGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHV 186
            |..|..|::...|....|.  .||:.:.||||.|:..|.:|.|:|:.|.|.|:  ..| :.|.:.
Zfish   119 PAELSATIQPAVLPVSVPALQGGTVCIVSGWGVTQVYSYYLSPVLRAVDVQII--PQC-QYYYYY 180

  Fly   187 NITIDMICAD---GQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGTN--PGVYEDIAFFH 246
            .||.:|:||.   |.: |:||||||||||   ..|:.:  |:||||..|...  ||||..:..:.
Zfish   181 RITDNMVCAGSPLGGK-DSCQGDSGGPLI---CNGYFE--GIVSWGISCANAYFPGVYTKVRNYI 239

  Fly   247 NWIKYTV 253
            .|:.:.:
Zfish   240 PWMTWII 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 82/234 (35%)
Tryp_SPc 29..250 CDD:238113 82/234 (35%)
si:dkey-33m11.8XP_693464.3 Tryp_SPc 23..241 CDD:214473 82/233 (35%)
Tryp_SPc 24..241 CDD:238113 81/232 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.