DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and PRSS3

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:240 Identity:83/240 - (34%)
Similarity:120/240 - (50%) Gaps:23/240 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCLSNVTVTDLSVRAGS---SY 87
            :::||||.......:|:|||: |:..|.|||.:.|::.:::||||..    |.:.||.|.   ..
Human   107 DDKIVGGYTCEENSLPYQVSL-NSGSHFCGGSLISEQWVVSAAHCYK----TRIQVRLGEHNIKV 166

  Fly    88 WSKGGQVLKVLKTIAHPKY-VPKLYNPYDIAVLILEAPLRLGGTVKKIPLAEQTPVAGTIVLTSG 151
            .....|.:...|.|.|||| ...|.|  ||.::.|.:|..:...|..|.|....|.|||..|.||
Human   167 LEGNEQFINAAKIIRHPKYNRDTLDN--DIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISG 229

  Fly   152 WGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHVNITIDMICA---DGQRWDTCQGDSGGPLIE 213
            ||.|....:.....|:.:...:|.:.:|..:|.. .||..|.|.   :|.: |:||.|||||:: 
Human   230 WGNTLSFGADYPDELKCLDAPVLTQAECKASYPG-KITNSMFCVGFLEGGK-DSCQRDSGGPVV- 291

  Fly   214 TTKGGHRQLIGMVSWGDGCG--TNPGVYEDIAFFHNWIKYTVKKN 256
                .:.||.|:||||.||.  ..||||..:..:.:|||.|:..|
Human   292 ----CNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAAN 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 78/229 (34%)
Tryp_SPc 29..250 CDD:238113 79/229 (34%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 78/229 (34%)
Tryp_SPc 110..328 CDD:238113 81/231 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.