DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and PRSS1

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:251 Identity:85/251 - (33%)
Similarity:127/251 - (50%) Gaps:28/251 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AARIPGP---EERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCL-SNVTVT-- 77
            ||.:..|   :::||||.......||:|||: |:..|.|||.:.:::.:::|.||. |.:.|.  
Human   236 AAALAAPFDDDDKIVGGYNCEENSVPYQVSL-NSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLG 299

  Fly    78 --DLSVRAGSSYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGTVKKIPLAEQT 140
              ::.|..|:.      |.:...|.|.||:|..|..| .||.::.|.:...:...|..|.|....
Human   300 EHNIEVLEGNE------QFINAAKIIRHPQYDRKTLN-NDIMLIKLSSRAVINARVSTISLPTAP 357

  Fly   141 PVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHVNITIDMICA---DGQRWDT 202
            |..||..|.||||.|..:.:.....||.:...:|::..|..:|.. .||.:|.|.   :|.: |:
Human   358 PATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPG-KITSNMFCVGFLEGGK-DS 420

  Fly   203 CQGDSGGPLIETTKGGHRQLIGMVSWGDGCG--TNPGVYEDIAFFHNWIKYTVKKN 256
            ||||||||::     .:.||.|:|||||||.  ..||||..:..:..|||.|:..|
Human   421 CQGDSGGPVV-----CNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAAN 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 77/230 (33%)
Tryp_SPc 29..250 CDD:238113 78/230 (34%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 77/230 (33%)
Tryp_SPc 249..467 CDD:238113 80/232 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.