DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and try10

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001011209.1 Gene:try10 / 496640 XenbaseID:XB-GENE-6453489 Length:243 Species:Xenopus tropicalis


Alignment Length:262 Identity:90/262 - (34%)
Similarity:140/262 - (53%) Gaps:37/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCLSN 73
            :|.|:.|||.|..|. .:::||||.:..   ||:|||: |...|.|||.:.::..:::||||..:
 Frog     5 LLFSLLGLAVAQPIE-DDDKIVGGYHCS---VPYQVSL-NAGYHFCGGSLINEHWVVSAAHCYQS 64

  Fly    74 -----VTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKYVPKLYNPY----DIAVLILEAPLRLGG 129
                 :...::.:..|:.      |.::..|.|.||:     ||.:    ||.::.|:.|.:|..
 Frog    65 KMELRIGENNIELLEGTE------QFIQSAKIIRHPQ-----YNSWTIDNDIMLIQLQEPAQLNN 118

  Fly   130 TVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHVNITIDMIC 194
            .|:.|||..:.|..|:|.|.||||.|..|......:||.:...||:..:|.::|.. :||.:|||
 Frog   119 EVQPIPLPTECPPVGSICLISGWGNTLSNGVNYPDLLQCIEAPILSDQECRQSYPG-SITDNMIC 182

  Fly   195 A---DGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGT--NPGVYEDIAFFHNWIKYTVK 254
            .   :| ..|:||||||||::  ..|   :|.|:||||.||..  .||||..:..:.:||:.|:.
 Frog   183 VGYLEG-GIDSCQGDSGGPVV--CDG---ELQGVVSWGRGCALPGYPGVYTKVCNYLSWIRDTIA 241

  Fly   255 KN 256
            .|
 Frog   242 NN 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 79/234 (34%)
Tryp_SPc 29..250 CDD:238113 80/234 (34%)
try10NP_001011209.1 Tryp_SPc 24..239 CDD:238113 81/236 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.