DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and prss27

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_031749235.1 Gene:prss27 / 496619 XenbaseID:XB-GENE-5744470 Length:724 Species:Xenopus tropicalis


Alignment Length:280 Identity:88/280 - (31%)
Similarity:140/280 - (50%) Gaps:27/280 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCLRLLLSILV--SIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRA 63
            |.||::..:|.  ::..::.....|...:|||||:.......|||||:...:.|.|||.:.|...
 Frog   390 MMLRIISLLLAGFAVTAISTGCGQPAFSDRIVGGNNAVFGEWPWQVSIVYQNSHICGGSLVSSNW 454

  Fly    64 ILTAAHCL-SNVTVTDLSVRAGS---SYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAP 124
            :::||||. .:..:.::.|..|.   ...:....:::|.:.|.:|.|..: .:..|||::.:|:|
 Frog   455 VVSAAHCFPRSYKIENMQVLLGCFALMNLTSDAVIIRVKRVITYPLYTGE-GSSGDIAMVEMESP 518

  Fly   125 LRLGGTVKK--IPLAEQTPVAGTIVLTSGWGYTRENSSFLWPI-LQGVHVAILNRTDCLKAYKHV 186
            :.....:..  |||..:...:|.:...:|||..:.:.|...|. ||.|.|.::|.:.|...| |.
 Frog   519 VTYSSYILPICIPLTNEDFPSGKMCWVTGWGNIQSDVSLSPPYPLQEVEVPLVNASSCDTMY-HY 582

  Fly   187 NITI---------DMICA---DGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCG--TNPG 237
            |..:         |||||   :||: |.||||||||| ....|.:..|.|:|||||||.  ..||
 Frog   583 NSDLNPATQLVHDDMICAGYPEGQK-DACQGDSGGPL-ACKSGNYWFLTGIVSWGDGCAQPNRPG 645

  Fly   238 VYEDIAFFHNWIKYTVKKNI 257
            ||..::.|.:||...:..|:
 Frog   646 VYTKVSSFSSWINQYLVLNV 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 80/241 (33%)
Tryp_SPc 29..250 CDD:238113 80/241 (33%)
prss27XP_031749235.1 Tryp_SPc 34..271 CDD:238113
Tryp_SPc 420..659 CDD:238113 81/242 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.