DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and deltaTry

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_523694.2 Gene:deltaTry / 48343 FlyBaseID:FBgn0010358 Length:253 Species:Drosophila melanogaster


Alignment Length:256 Identity:103/256 - (40%)
Similarity:139/256 - (54%) Gaps:19/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLSILVSIAGLACA-------ARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRA 63
            :|..::.::.:|||       ..:|..:.||||||...|...|||:|:|.:..|.|||.|||...
  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNV 65

  Fly    64 ILTAAHCLSNVTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKY-VPKLYNPYDIAVLILEAPLRL 127
            |:||||||.:|:.:.|.:||||||||.||....|.....|..| ...:.|  |||::.:...|..
  Fly    66 IVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVN--DIAIIKINGALTF 128

  Fly   128 GGTVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKA-YKH-VNITI 190
            ..|:|.|.||...|..|.....||||.....||.:...||.|:|.|::::.|..: |.: ..|..
  Fly   129 SSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRS 193

  Fly   191 DMICADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGTN--PGVYEDIAFFHNWI 249
            .||||.....|.|||||||||:   .||  .|:|:||||.||..:  ||||.|:|...:|:
  Fly   194 TMICAAASGKDACQGDSGGPLV---SGG--VLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 97/225 (43%)
Tryp_SPc 29..250 CDD:238113 97/226 (43%)
deltaTryNP_523694.2 Tryp_SPc 30..249 CDD:214473 97/225 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443213
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.