DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and CG34129

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster


Alignment Length:290 Identity:74/290 - (25%)
Similarity:123/290 - (42%) Gaps:51/290 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILVSIAGLACAARIPG---PEE---------RIVGG--SYIPIEYVPWQVSVQN-NSLHCCGGVI 58
            :|||.....|..:..|   |.:         |:.||  |.....:..|.:.:.| :....||...
  Fly     8 LLVSCLLWTCLPQSQGTVYPRDILLKTPKFRRVWGGVQSNTGPNFGGWLLRILNGDGNFACGAAY 72

  Fly    59 YSDRAILTAAHC-------LSNVTVTDLSVRAGSSYWSKGGQVLKVLKTIAHP-KYV-PKLYNPY 114
            |:...::|:|:|       |...||      .|:::.....:....:.||..| |:: .|||  .
  Fly    73 YAPLLVITSANCIYPYRNSLEGATV------EGTAFSECDRENYADIDTIQFPEKFIYQKLY--M 129

  Fly   115 DIAVLILEAPLRLGGTVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPIL--QGVHVAILNRT 177
            |:||:.|..|:| |...:.|.|..........::..|||:  :|:....|..  :.|.|.|::..
  Fly   130 DVAVVRLRDPVR-GRLTEFIRLCSVKVQPKMQMVVFGWGF--DNTEVEIPSSDPRNVTVTIISIK 191

  Fly   178 DCLKAYKHVNITIDMICA-DGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGC--GTNPGVY 239
            :|.:.:|...|....||| ..:....|..|.|.|||.     .|:|.|:||:|..|  .:.||:|
  Fly   192 ECRQKFKSPKIASTSICARQPKNPKQCLYDGGSPLIY-----GRELCGVVSFGSHCIDTSRPGMY 251

  Fly   240 EDIAFFHNWIKYTVKK----NIYKS--IVK 263
            .:|.....:|..|.:.    ::::|  :||
  Fly   252 TNIRRVKRFITETEESINAGDVFRSTKVVK 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 63/237 (27%)
Tryp_SPc 29..250 CDD:238113 62/237 (26%)
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 63/237 (27%)
Tryp_SPc 55..261 CDD:304450 59/221 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.