DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and CG4053

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_650601.2 Gene:CG4053 / 42070 FlyBaseID:FBgn0038482 Length:265 Species:Drosophila melanogaster


Alignment Length:234 Identity:76/234 - (32%)
Similarity:123/234 - (52%) Gaps:16/234 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EERIVGGSYIPIEYVPWQVSVQNN-SLHCCGGVIYSDRAILTAAHCLSNVTVTDLSVRAGSSYWS 89
            :.|||||........|:|||:|.. ..|.|.|||.:::.||||.||..:.::.||.:..|::...
  Fly    32 DNRIVGGQEAEDGVAPYQVSIQTIWKTHICSGVILNEQWILTAGHCALDFSIEDLRIIVGTNDRL 96

  Fly    90 KGGQVLKVLKTIAHPKY-VPKLYNPYDIAVLILEAPLRLGGTVKKIPLAEQTPVAGTIVLTSGWG 153
            :.||.|...:.:.|..| :|.:|| .|||::.:...:......:.:.|:.:.|.||:.|..:|||
  Fly    97 EPGQTLFPDEALVHCLYDIPYVYN-NDIALIHVNESIIFNDRTQIVELSREQPPAGSTVTLTGWG 160

  Fly   154 YTRENSSFLWPILQGVHVAILNRTDCLKAYK-HVNITIDMICA---DGQRWDTCQGDSGGPLIET 214
             ..|:|......||.:::.|:...:|.:.:. |..|.|..||.   :|:  ..|.|||||||:..
  Fly   161 -APESSYPTVQYLQTLNLTIIAHEECRERWDFHDGIDIGHICTFTREGE--GACSGDSGGPLMWE 222

  Fly   215 TKGGHRQLIGMVSWGDGCGTN-PGVYEDIAFFHNWIKYT 252
            .|     |:|:|:||..||.. |.:|.:..::.:||:.|
  Fly   223 GK-----LVGLVNWGRACGVGMPDMYANTVYYQDWIRRT 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 73/227 (32%)
Tryp_SPc 29..250 CDD:238113 73/227 (32%)
CG4053NP_650601.2 Tryp_SPc 34..253 CDD:214473 73/227 (32%)
Tryp_SPc 35..256 CDD:238113 74/229 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.