DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and CG10405

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster


Alignment Length:269 Identity:88/269 - (32%)
Similarity:125/269 - (46%) Gaps:32/269 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLSILVSIAGLACAARIP-GPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAA 68
            |:..|||.:......|.:| .|:.|||.|........|:|:|::..::|.||..|.|....:|||
  Fly    12 LIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGASILSSNWAITAA 76

  Fly    69 HCLS--NVTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVL-----ILEAPLR 126
            ||:.  .....:.::|.||...:.||.|..|.....||.|.....| :|:|:|     .|..|| 
  Fly    77 HCIDGHEQQPREFTLRQGSIMRTSGGTVQPVKAIYKHPAYDRADMN-FDVALLRTADGALSLPL- 139

  Fly   127 LGGTVKKIPLAEQTPVAGTIV------LTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYK- 184
              |.|..|.|    |..|..:      :.||||:...::..|..:|:...|..:|:..|....: 
  Fly   140 --GKVAPIRL----PTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTVNQEKCHNDLRH 198

  Fly   185 HVNITIDMICADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGT--NPGVYEDIAF--F 245
            |..:|..|.||..:..|.||||||||:  :.:|   .|||:||||.||..  .||||..:|.  .
  Fly   199 HGGVTEAMFCAAARNTDACQGDSGGPI--SAQG---TLIGIVSWGVGCADPYYPGVYTRLAHPTI 258

  Fly   246 HNWIKYTVK 254
            ..||:...|
  Fly   259 RRWIRLLTK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 78/238 (33%)
Tryp_SPc 29..250 CDD:238113 78/238 (33%)
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 78/238 (33%)
Tryp_SPc 37..263 CDD:238113 78/238 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443335
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.