DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and CG16749

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_649881.1 Gene:CG16749 / 41111 FlyBaseID:FBgn0037678 Length:265 Species:Drosophila melanogaster


Alignment Length:272 Identity:91/272 - (33%)
Similarity:134/272 - (49%) Gaps:42/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCLRLLLSILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNS-LHCCGGVIYSDRAI 64
            :||.:.  .|::.||::..|...|   |:|.|:...:|..|:.:|::.:| .|.|||.|.|.:.:
  Fly     7 LCLAVF--ALLTTAGISHGAPQMG---RVVNGTDSSVEKYPFVISMRGSSGSHSCGGSIISKQFV 66

  Fly    65 LTAAHCLSNVTVTDLSVRAG-SSYWSKGGQVLKVLKTIAHPKYVPKLYNPY--DIAVLILEAPLR 126
            :|||||......:||||:.| :...:.|..|::|.|.|.|..|.|  ||.|  ||::|::|.|..
  Fly    67 MTAAHCTDGRKASDLSVQYGVTKINATGPNVVRVKKIIQHEDYNP--YNNYANDISLLLVEEPFE 129

  Fly   127 LGG-TVKKIPLAE------QTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYK 184
            ..| ||..:.|.|      ||...|..||. ||| ......::...||.|.:.:.:..:|.:  :
  Fly   130 FDGVTVAPVKLPELAFATPQTDAGGEGVLI-GWG-LNATGGYIQSTLQEVELKVYSDEECTE--R 190

  Fly   185 HVNITIDM--IC------ADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWG-DGC--GTNPGV 238
            |...|...  ||      ..||    |.||||||||.     :.|.:|:|||. ..|  ...|||
  Fly   191 HGGRTDPRYHICGGVDEGGKGQ----CSGDSGGPLIY-----NGQQVGIVSWSIKPCTVAPYPGV 246

  Fly   239 YEDIAFFHNWIK 250
            |..::.:.:|||
  Fly   247 YCKVSQYVDWIK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 81/242 (33%)
Tryp_SPc 29..250 CDD:238113 81/242 (33%)
CG16749NP_649881.1 Tryp_SPc 29..257 CDD:214473 81/242 (33%)
Tryp_SPc 30..259 CDD:238113 83/244 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104239at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.