DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and CG12951

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:266 Identity:80/266 - (30%)
Similarity:121/266 - (45%) Gaps:34/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLSILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQN-NSLHCCGGVIYSDRAILTAA 68
            |.||::|.:|........|. ..|:|.|:...:...|:.||::: :..|.|||.|.|...::|||
  Fly     7 LSLSLIVILAVTTVGQAAPS-ISRVVNGTDSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAA 70

  Fly    69 HCLSNVTVTDLSVRAG-SSYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGT-- 130
            ||.:......||::.| ::..:.|..|:.:.|.|.|..:.|...|..||::|::|.|....|.  
  Fly    71 HCTNGRPADTLSIQFGVTNISAMGPNVVGIKKIIQHEDFDPTRQNANDISLLMVEEPFEFDGVSV 135

  Fly   131 --VKKIPLAEQTP-----VAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHVNI 188
              |:...||...|     |.|.::   |||......| :...||.|.:.|.:..:|...:.....
  Fly   136 APVELPALAFAVPQSDAGVEGVLI---GWGLNDTYGS-VQDTLQEVSLKIYSDEECTSRHNGQTD 196

  Fly   189 TIDMIC------ADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWG-DGC--GTNPGVYEDIAF 244
            ....||      ..||    |.||||||||.     :.|.:|:|||. ..|  ...||||..::.
  Fly   197 PKYHICGGVDEGGKGQ----CSGDSGGPLIY-----NGQQVGIVSWSIKPCTVAPYPGVYCKVSQ 252

  Fly   245 FHNWIK 250
            :.:|||
  Fly   253 YVDWIK 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 71/240 (30%)
Tryp_SPc 29..250 CDD:238113 71/240 (30%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 71/240 (30%)
Tryp_SPc 30..260 CDD:238113 73/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.