DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and Klk4

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:254 Identity:80/254 - (31%)
Similarity:127/254 - (50%) Gaps:23/254 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSV--QNNSLHCCGGVIYSDRAILTAAHCL 71
            :::.:.| :.|:.|   ..||:.|........|||.::  ::|:.. |.||:...:.:|:||||:
  Rat    16 LILEVTG-SSASSI---SSRIIQGQDCLPHSQPWQAALFSEDNAFF-CSGVLVHPQWVLSAAHCI 75

  Fly    72 SNVTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKY-VPKLYNPYDIAVLILEAPLRLGGTVKKIP 135
            .:.....|.:.........|.::|:...:|.||.| .|...|  |:.::.|...:....|:::||
  Rat    76 QDSYTVGLGLHNLEGSQEPGSRMLEAHLSIQHPNYNDPSFAN--DLMLIKLNESVMESNTIRRIP 138

  Fly   136 LAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHVNITIDMICADG--Q 198
            :|.|.|..|...|.||||  |..:..|..:||.|::::.:...|...|..| ..:.|.||.|  .
  Rat   139 VASQCPTPGDTCLVSGWG--RLKNGKLPSLLQCVNLSVASEETCRLLYDPV-YHLSMFCAGGGPD 200

  Fly   199 RWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDG-CGTN--PGVYEDIAFFHNWIKYTVK 254
            |.|||.||||||::     .:|.|.|:||.|.| ||..  |.||.::..|.|||..|::
  Rat   201 RKDTCNGDSGGPIV-----CNRSLQGLVSMGQGECGQPGIPSVYTNLCKFTNWIWTTIQ 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 74/228 (32%)
Tryp_SPc 29..250 CDD:238113 74/228 (32%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 72/224 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.