DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and CG10587

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:273 Identity:83/273 - (30%)
Similarity:140/273 - (51%) Gaps:38/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSILVSIAGLACAARIPGPEERIVGGSYIP-IEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHC 70
            |:..:.:..||...:.||.:.|:|||.... .:...:.::::......|||.:..|..:||||||
  Fly    24 LNQTIDVNKLAKIVQRPGFQTRVVGGDVTTNAQLGGYLIALRYEMNFVCGGTLLHDLIVLTAAHC 88

  Fly    71 -LSNVTVTDLSVRAGSSYWSKGG---QVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGTV 131
             |..|.::|.....|:|..:..|   ||.:|:|:....:....:    |:|:|.|:.|:: |.::
  Fly    89 FLGRVKISDWLAVGGASKLNDRGIQRQVKEVIKSAEFREDDMNM----DVAILRLKKPMK-GKSL 148

  Fly   132 KKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWP--ILQGVHVAILNRTDCLKAY--------KH- 185
            .::.|.::..:.||.:..||||.| |||.| .|  :|:.|.|.::::..|..:|        || 
  Fly   149 GQLILCKKQLMPGTELRVSGWGLT-ENSEF-GPQKLLRTVTVPVVDKKKCRASYLPTDWESHKHF 211

  Fly   186 -----VNITIDMICAD--GQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGTNP--GVYED 241
                 |::|..|.||.  |:: |.|..||||||:.     ..|:.|:||:|.||.:..  |||.|
  Fly   212 DLFLKVHLTDSMFCAGVLGKK-DACTFDSGGPLVY-----KNQVCGIVSFGIGCASKRYYGVYTD 270

  Fly   242 IAFFHNWIKYTVK 254
            |.:...:|:.::|
  Fly   271 IMYVKPFIEQSIK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 76/245 (31%)
Tryp_SPc 29..250 CDD:238113 75/245 (31%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 76/245 (31%)
Tryp_SPc 46..280 CDD:238113 76/246 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.