DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and CG11037

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_649272.1 Gene:CG11037 / 40317 FlyBaseID:FBgn0037038 Length:292 Species:Drosophila melanogaster


Alignment Length:273 Identity:80/273 - (29%)
Similarity:133/273 - (48%) Gaps:43/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SILVSIAGLACAARIPGPEE-RIVG---------GSYIPI-----EYVPWQVSVQNNSLHCCGGV 57
            ::.:.:|.||... :|.|.| |::|         |.|:..     ::|             |||.
  Fly    41 NLTLDVAQLAKIV-LPSPHETRVIGGHVTTNAKLGGYLTALLYEDDFV-------------CGGT 91

  Fly    58 IYSDRAILTAAHC-LSNVTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLIL 121
            :.::..:|||||| |..:..::..|.||.|..::.|....|...|...::.....| .|:||::|
  Fly    92 LLNENIVLTAAHCFLGRMKASEWIVAAGISNLNQKGIRRHVKDFILSEQFREDDMN-MDVAVVLL 155

  Fly   122 EAPLRLGGTVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYK-H 185
            :.||: ...:..:.|...:...|..::.||||.|.........:|:.|.|.|:::.:|..||: .
  Fly   156 KTPLK-AKNIGTLSLCSVSLKPGVELVVSGWGMTAPRGRGPHNLLRTVTVPIIHKKNCRAAYQPT 219

  Fly   186 VNITIDMICAD--GQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGTN--PGVYEDIAFFH 246
            ..||..||||.  |:: |.|..||||||:     ..:|:.|:||:|.||.:|  ||||.|:.:..
  Fly   220 AKITDSMICAAVLGRK-DACTFDSGGPLV-----FKKQVCGIVSFGIGCASNRYPGVYTDVMYVK 278

  Fly   247 NWIKYTVKKNIYK 259
            .:|:.::|..:.|
  Fly   279 PFIEKSIKALLAK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 71/240 (30%)
Tryp_SPc 29..250 CDD:238113 70/240 (29%)
CG11037NP_649272.1 Tryp_SPc 61..281 CDD:214473 71/240 (30%)
Tryp_SPc 62..283 CDD:238113 71/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.