DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and CG3650

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:258 Identity:78/258 - (30%)
Similarity:127/258 - (49%) Gaps:23/258 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLSILVSIAGLACAARIPGPEERIVGGSYIPIEYV-PWQVSVQNNSLHCCGGVIYSDRAILTAAH 69
            ||.:...:.|||.....|    |||||:...:..| .:.|:::.:....|||.:.:...::||||
  Fly     7 LLQLTQLLLGLASGQIQP----RIVGGTTTTLSAVGGFVVNLRYDGTFYCGGSLVTSSHVVTAAH 67

  Fly    70 CLSNVTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKYVPKLYNP----YDIAVLILEAPLRLGGT 130
            ||.....:.::|:.|.|..|:.|.|.:|.:     .::|..::.    :|:.|:.|::.| .|..
  Fly    68 CLKGYQASRITVQGGVSKLSQSGVVRRVAR-----YFIPNGFSSSSLNWDVGVIRLQSAL-TGSG 126

  Fly   131 VKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYK-HVNITIDMIC 194
            :..|||.:.....|..:..||||.||..:|.....|:.|.:.::.:..|.:||: ...:|....|
  Fly   127 ITTIPLCQVQWNPGNYMRVSGWGTTRYGNSSPSNQLRTVRIQLIRKKVCQRAYQGRDTLTASTFC 191

  Fly   195 ADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGT--NPGVYEDIAFFHNWIKYTVKK 255
            |.....|:|.|||||.:|     ...||.|:||||.||..  .||||..:....::|..::||
  Fly   192 ARTGGKDSCSGDSGGGVI-----FKNQLCGIVSWGLGCANAQYPGVYTSVHRVRSFILRSIKK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 69/228 (30%)
Tryp_SPc 29..250 CDD:238113 68/228 (30%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 69/228 (30%)
Tryp_SPc 26..243 CDD:238113 68/227 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.