DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and CG13430

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001027441.1 Gene:CG13430 / 3772580 FlyBaseID:FBgn0034518 Length:267 Species:Drosophila melanogaster


Alignment Length:238 Identity:91/238 - (38%)
Similarity:126/238 - (52%) Gaps:13/238 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCLSNVTVTDLSV-RAGSSYWSKG 91
            |||||....|.:.|.|||:|..:.|.|||.|.|...|||||||:...:.....| |||||.|:||
  Fly    31 RIVGGWETHITFFPHQVSLQLGTRHACGGTIISPNIILTAAHCVLEYSKPQYYVIRAGSSDWTKG 95

  Fly    92 GQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGTVKKIPLAEQ----TPVAGTIVLTSGW 152
            |..::|.|.|.||::........|||::.|:.||.....::.|.||..    .|.|...|  |||
  Fly    96 GSYIRVKKIIPHPEFHDPTRMNNDIAIVQLQQPLVYSQDIRPISLATSKDIIMPTAQLFV--SGW 158

  Fly   153 GYTRENSSFLWPILQGVHVAILNRTDCLKAYKHV-NITIDMICADGQRW--DTCQGDSGGPLIET 214
            |.|..:.......|:...|.:.::..|.:.|... .:|..|.||..|..  |:|||||||||: |
  Fly   159 GSTSISQMQPEKRLRYTVVHLRDQNQCARNYFGAGTVTNTMFCAGTQAGGRDSCQGDSGGPLV-T 222

  Fly   215 TKGGHRQLIGMVSWGDGCGTN--PGVYEDIAFFHNWIKYTVKK 255
            :..|..:|.|:||||.||...  ||:|..::.:.:||..|:::
  Fly   223 SIDGRLKLYGIVSWGFGCANAMFPGIYTKVSAYDDWIAQTIEE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 88/230 (38%)
Tryp_SPc 29..250 CDD:238113 88/230 (38%)
CG13430NP_001027441.1 Tryp_SPc 31..259 CDD:214473 88/230 (38%)
Tryp_SPc 32..262 CDD:238113 89/232 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443258
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.