DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and CG9897

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:277 Identity:74/277 - (26%)
Similarity:114/277 - (41%) Gaps:36/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCLRLLLSILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAIL 65
            |...|:|..:|::..||..      ::||:.|:.:.|:..||..|:..||...|||.|.|...||
  Fly     1 MLAPLILLQIVALPWLALG------DQRIINGNTVNIKDAPWYASIIVNSKLKCGGAIISKNYIL 59

  Fly    66 TAAHCLSNVTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGT 130
            |||.|:...:...:.||.|:|.....|.:..:.|...|.:|....:: .::|:|.....|.....
  Fly    60 TAAKCVDGYSARSIQVRLGTSSCGTSGSIAGICKVKVHSQYSSWRFD-NNLALLKTCELLNTTDE 123

  Fly   131 VKKIPLAEQTPVAGTIVLTSGWGYTR----------------ENSSFLWPI-LQGVHVAILNRTD 178
            :|.|..|::.|...:....:|.|...                |...|..|: |.|..|.||::..
  Fly   124 IKPIERADKVPDDNSRANVTGCGGRSGNFLDLILDLRISSGIEEKCFQLPVQLHGTQVRILSQKQ 188

  Fly   179 CLKAYKHV------NITIDMICADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGTNPG 237
            |...:|.:      .|:...||........|..|.|.||:...|     |:|::|.. ||...|.
  Fly   189 CAADWKVIPFYLLKGISDLTICTKSPGKGACSTDRGSPLVIDNK-----LVGILSRA-GCSIKPD 247

  Fly   238 VYEDIAFFHNWIKYTVK 254
            ||.:|....||:....|
  Fly   248 VYANILGHTNWLDSNTK 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 66/243 (27%)
Tryp_SPc 29..250 CDD:238113 66/243 (27%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 65/242 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.