DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and CG32833

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:238 Identity:63/238 - (26%)
Similarity:97/238 - (40%) Gaps:31/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCLSNVTVTDLSVRAGSSYWSKGGQV 94
            :||..:.|...||..|:.......|.|.||....|:||..|:.......:.||.||:..|.|...
  Fly    39 LGGHPVNITTAPWIASISIKQKAKCDGAIYKLSHIVTAGKCVDGFLNKVIRVRVGSTTRSDGVIE 103

  Fly    95 LKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGTVKKIPLAEQTPVAGTIVLTSGWGYTRENS 159
            :.|.....|.|:..:... :::|:|.|..||....|::.|.||.|.|..|..|..:||      .
  Fly   104 VAVCNITVHEKFTGQTVF-HNVAILKLCEPLEASKTIQPIQLANQLPSNGAKVTANGW------P 161

  Fly   160 SFLWPI-------------LQGVHVAILNRTDCL-----KAYKHVNITIDMICADGQRWDTCQGD 206
            ||.|..             ||...|.:|..:.|.     ..:...|.|.|:.|.:....:.|...
  Fly   162 SFRWWAMYWKKCLDDEAYKLQKAEVKLLGPSQCTDLWARNNWSKKNFTDDLFCTEKFAKEACSLA 226

  Fly   207 SGGPLIETTKGGHRQLIGMVSWGDGCGTNPGVYEDIAFFHNWI 249
            .|.|::...|     |:|:::.| ||...|.||.::..:.:|:
  Fly   227 MGSPVVHNGK-----LVGIITKG-GCSEYPEVYINLIKYKDWL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 62/236 (26%)
Tryp_SPc 29..250 CDD:238113 63/238 (26%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 63/237 (27%)
Tryp_SPc 40..262 CDD:214473 62/234 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.