DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and CG11192

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:255 Identity:105/255 - (41%)
Similarity:139/255 - (54%) Gaps:17/255 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCL 71
            |..||:.||   |...|| :.|||||....|:..|:|||||....|.|||.|.....:||||||.
  Fly    10 LMALVAYAG---ATPTPG-DGRIVGGEVATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCF 70

  Fly    72 SNV-TVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGTVKKIP 135
            .:. :..|.:||.|||....||.||.:.:.|||..|.|:.:: .|:|:|||...|.....::.:|
  Fly    71 EDPWSSADYTVRVGSSEHESGGHVLSLRRVIAHGDYNPQSHD-NDLALLILNGQLNFTEHLQPVP 134

  Fly   136 LA--EQTPVAGTIVLTSGWGYTRENSSF-----LWPILQGVHVAILNRTDCLKAYKHV-NITIDM 192
            ||  ...|.|.|.:..||||:..|.|:.     :.|.|:.|.|.::....|.:||..| .||..|
  Fly   135 LAALADPPTADTRLQVSGWGFQAEESAVSGEVGVSPQLRFVDVDLVESNQCRRAYSQVLPITRRM 199

  Fly   193 ICADGQRWDTCQGDSGGPLI-ETTKGGHRQLIGMVSWGDGCGTN--PGVYEDIAFFHNWI 249
            |||.....|:|||||||||: ...:.|..:|.|:||||.||...  ||||.::|.|.:||
  Fly   200 ICAARPGRDSCQGDSGGPLVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 95/232 (41%)
Tryp_SPc 29..250 CDD:238113 96/233 (41%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 95/232 (41%)
Tryp_SPc 28..262 CDD:238113 96/233 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443274
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.