DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and Prss3

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001102096.1 Gene:Prss3 / 362347 RGDID:1311446 Length:246 Species:Rattus norvegicus


Alignment Length:262 Identity:90/262 - (34%)
Similarity:137/262 - (52%) Gaps:24/262 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LRLLLSILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTA 67
            :|.||  .:::.|:|.|..: ..:::||||.......||:|||: |:..|.|||.:.:|:.:::|
  Rat     1 MRALL--FLALVGVAVAFPV-DDDDKIVGGYTCQENSVPYQVSL-NSGYHFCGGSLINDQWVVSA 61

  Fly    68 AHCLSNVTVTDLSVRAGS---SYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGG 129
            |||..    |.:.||.|.   :......|.:...|.|.||.:..:..| .||.::.|.:|::|..
  Rat    62 AHCYK----TRIQVRLGEHNINVLEGDEQFVNAAKIIKHPNFNARNLN-NDIMLIKLSSPVKLNA 121

  Fly   130 TVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHVNITIDMIC 194
            .|..:.|......|||..|.||||.|.........:||.:...:|.:.||..:|.. .||.:|||
  Rat   122 RVATVALPSSCAPAGTQCLISGWGNTLSLGVNNPDLLQCLDAPVLPQADCEASYPG-KITNNMIC 185

  Fly   195 A---DGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCG--TNPGVYEDIAFFHNWIKYTVK 254
            .   :|.: |:||||||||::     .:.||.|:||||.||.  .|||||..:..:.:||:.|:.
  Rat   186 VGFLEGGK-DSCQGDSGGPVV-----CNGQLQGIVSWGYGCALKDNPGVYTKVCNYVDWIQDTIA 244

  Fly   255 KN 256
            .|
  Rat   245 AN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 80/228 (35%)
Tryp_SPc 29..250 CDD:238113 81/228 (36%)
Prss3NP_001102096.1 Tryp_SPc 23..239 CDD:214473 80/228 (35%)
Tryp_SPc 24..242 CDD:238113 82/230 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.