DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and iotaTry

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_523695.1 Gene:iotaTry / 36223 FlyBaseID:FBgn0015001 Length:252 Species:Drosophila melanogaster


Alignment Length:227 Identity:91/227 - (40%)
Similarity:126/227 - (55%) Gaps:13/227 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCLSNVTVTDLSVRAGSSYWSKGG 92
            ||:|||...|...|||||:|.::.|.|||||||...|:||.|||...:||.:.||.|:...:.||
  Fly    27 RIIGGSDQLIRNAPWQVSIQISARHECGGVIYSKEIIITAGHCLHERSVTLMKVRVGAQNHNYGG 91

  Fly    93 QVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGTVKKIPLAEQTPVAGTIVLTSGWGYTRE 157
            .::.|.....|.::..:..: ||||||.|..||..|.:.:.|.||..:|..||.|..:|||:|  
  Fly    92 TLVPVAAYKVHEQFDSRFLH-YDIAVLRLSTPLTFGLSTRAINLASTSPSGGTTVTVTGWGHT-- 153

  Fly   158 NSSFLWPILQGVHVAILNRTDCLK---AYKHVNITIDMICADGQRWDTCQGDSGGPLIETTKGGH 219
            ::..|...||...:.|::|.:|..   .|....:..:.|||.....|.|.|||||||:.::    
  Fly   154 DNGALSDSLQKAQLQIIDRGECASQKFGYGADFVGEETICAASTDADACTGDSGGPLVASS---- 214

  Fly   220 RQLIGMVSWGDGCGTN--PGVYEDIAFFHNWI 249
             ||:|:||||..|..:  ||||.|:|....||
  Fly   215 -QLVGIVSWGYRCADDNYPGVYADVAILRPWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 89/225 (40%)
Tryp_SPc 29..250 CDD:238113 90/226 (40%)
iotaTryNP_523695.1 Tryp_SPc 27..245 CDD:214473 89/225 (40%)
Tryp_SPc 28..247 CDD:238113 90/226 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443178
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.