DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and gammaTry

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster


Alignment Length:256 Identity:103/256 - (40%)
Similarity:139/256 - (54%) Gaps:19/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLSILVSIAGLACA-------ARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRA 63
            :|..::.::.:|||       ..:|..:.||||||...|...|||:|:|.:..|.|||.|||...
  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNV 65

  Fly    64 ILTAAHCLSNVTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKY-VPKLYNPYDIAVLILEAPLRL 127
            |:||||||.:|:.:.|.:||||||||.||....|.....|..| ...:.|  |||::.:...|..
  Fly    66 IVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVN--DIAIIKINGALTF 128

  Fly   128 GGTVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKA-YKH-VNITI 190
            ..|:|.|.||...|..|.....||||.....||.:...||.|:|.|::::.|..: |.: ..|..
  Fly   129 SSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRS 193

  Fly   191 DMICADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGTN--PGVYEDIAFFHNWI 249
            .||||.....|.|||||||||:   .||  .|:|:||||.||..:  ||||.|:|...:|:
  Fly   194 TMICAAASGKDACQGDSGGPLV---SGG--VLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 97/225 (43%)
Tryp_SPc 29..250 CDD:238113 97/226 (43%)
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 97/225 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443193
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.