DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and thetaTry

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:264 Identity:95/264 - (35%)
Similarity:140/264 - (53%) Gaps:29/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RLLLSILVSIAGLACAARI------PGPEE-RIVGGSYIPIEYVPWQVSVQNNS-LHCCGGVIYS 60
            ||::.::....|.|||..:      |...| |||||....|...|:|||:|..| .|.|||.:.:
  Fly     3 RLVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLIN 67

  Fly    61 DRAILTAAHCLSNVTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPL 125
            :..::||||||....|:.:.||.||:.:::||.|:.|.:...:..|..|... ||:.:|.|:..:
  Fly    68 EDTVVTAAHCLVGRKVSKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTME-YDVGILKLDEKV 131

  Fly   126 RLGGTVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLW-----PILQGVHVAILNRTDCLK-AYK 184
            :....::.|.||.:||..||..:.:|||    :..:.|     ..||.|:|.|::...|.. .||
  Fly   132 KETENIRYIELATETPPTGTTAVVTGWG----SKCYFWCMTLPKTLQEVYVNIVDWKTCASDEYK 192

  Fly   185 HVNITID-MICADGQRWDTCQGDSGGPL-IETTKGGHRQLIGMVSWGDGCGTN--PGVYEDIAFF 245
            :..|..| |:||..::.|.||||||||| :..|      |:|:||||..|.:|  ||||.|:...
  Fly   193 YGEIIYDSMVCAYEKKKDACQGDSGGPLAVGNT------LVGIVSWGYACASNLLPGVYSDVPAL 251

  Fly   246 HNWI 249
            ..||
  Fly   252 RKWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 85/231 (37%)
Tryp_SPc 29..250 CDD:238113 86/232 (37%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 85/231 (37%)
Tryp_SPc 35..255 CDD:238113 84/230 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452474
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27101
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.