DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and zetaTry

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster


Alignment Length:272 Identity:93/272 - (34%)
Similarity:134/272 - (49%) Gaps:35/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLSILVSIAGLACAARI-------PGPEERIVGGSYIPIEYVPWQVSV--------QNNSLHCCG 55
            ||:.|||:..|.....:       ..|:.|||||....|..||:|:|:        :|...|.||
  Fly     9 LLAFLVSLVALTQGLPLLEDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRCG 73

  Fly    56 GVIYSDRAILTAAHCLSNVTVTDLSVRAGSSYWS-KGGQVLKVLKTIAHPKYVPKLYNPYDIAVL 119
            |.|:::..|:|||||:.....:...|.||:::.: ..|.:..|.:.:.|..|........|||:|
  Fly    74 GSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITNVKEIVMHEGYYSGAAYNNDIAIL 138

  Fly   120 ILEAPLRLGG-TVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAY 183
            .::.||.|.. |:|.|.||.:.|:.||:...|||| |.....:....|..|.|.|::...|.:.|
  Fly   139 FVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWG-TTSPGGYSSNQLLAVDVPIVSNELCDQDY 202

  Fly   184 KH-----VNITIDMICADGQRW----DTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCG--TNPG 237
            :.     ..||..|:|| |:|.    |.|||||||||     ....:|.|:||||:.|.  ..||
  Fly   203 EDFGDETYRITSAMLCA-GKRGVGGADACQGDSGGPL-----AVRDELYGVVSWGNSCALPNYPG 261

  Fly   238 VYEDIAFFHNWI 249
            ||.::|:...||
  Fly   262 VYANVAYLRPWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 84/241 (35%)
Tryp_SPc 29..250 CDD:238113 85/242 (35%)
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 84/241 (35%)
Tryp_SPc 39..276 CDD:238113 85/242 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443241
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.