DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and Phae2

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster


Alignment Length:276 Identity:81/276 - (29%)
Similarity:120/276 - (43%) Gaps:46/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLSILVSI-AGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAA 68
            |||::.||. :|||    :..||.|:|||........|:.||:|....|.|...|.:...::|||
  Fly    11 LLLAVCVSQGSGLA----LDQPEGRVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAA 71

  Fly    69 HCLSN--------VTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKYV-PKLYN----PYDIAVLI 120
            |||:|        :....::|...:|...|        :.|.|  || ..||.    ||||.::.
  Fly    72 HCLANRNQVLGSTLVAGSIAVAGTASTTQK--------RQITH--YVINDLYTGGTVPYDIGLIY 126

  Fly   121 LEAPLRLGGTVK--KIPLAEQTPVAGTIVLTSGWGYTRENSSFLWP--ILQGVHVAILNRTDCLK 181
            ..........|.  |:|.:...|.....:.  |||.|.:.:|..:|  :.:..::.|::...|..
  Fly   127 TPTAFTWTAAVAPVKLPSSGVRPTGKADLF--GWGSTSKTNSPSYPKTLQEAKNIPIISLDSCAA 189

  Fly   182 AY--KHVNITIDMICADGQRWDT--CQGDSGGPLIETTKGGHRQLIGMVSWGD-GCG--TNPGVY 239
            |.  |..::....:|.......|  |..||||||::     ...|||:||||. .||  .:|.||
  Fly   190 ALGSKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQ-----GNVLIGIVSWGKLPCGQPNSPSVY 249

  Fly   240 EDIAFFHNWIKYTVKK 255
            ..::.|..||....||
  Fly   250 VQVSSFITWIAANQKK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 67/244 (27%)
Tryp_SPc 29..250 CDD:238113 67/244 (27%)
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 67/244 (27%)
Tryp_SPc 32..262 CDD:238113 68/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.