DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and Try29F

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:253 Identity:97/253 - (38%)
Similarity:137/253 - (54%) Gaps:26/253 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCLSN 73
            :||::: |....|.|..:.|||||....|:.:|:|||:| .|.|.|||.:.:...:||||||...
  Fly    23 LLVNLS-LGATVRRPRLDGRIVGGQVANIKDIPYQVSLQ-RSYHFCGGSLIAQGWVLTAAHCTEG 85

  Fly    74 VTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKYVPKLYN-PYDIAVLILEAPLRLGGTVKKIPLA 137
            ..:....||.|||..|.|||::.:.:...|||:  ..|. .:|.::|.||.......|...:.|.
  Fly    86 SAILLSKVRIGSSRTSVGGQLVGIKRVHRHPKF--DAYTIDFDFSLLELEEYSAKNVTQAFVGLP 148

  Fly   138 EQ-TPVA-GTIVLTSGWGYT---RENSSFLWPILQGVHVAILNRTDCLKAYKHV-NITIDMICA- 195
            || ..:| ||.||.||||.|   :|.|:    :|:.|.|..:::|.|.:||.:. :||..|:|| 
  Fly   149 EQDADIADGTPVLVSGWGNTQSAQETSA----VLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAG 209

  Fly   196 --DGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCG--TNPGVYEDIAFFHNWI 249
              :|.: |.|||||||||     .....|.|:||||.||.  ..||||..::...:||
  Fly   210 LPEGGK-DACQGDSGGPL-----AADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 90/232 (39%)
Tryp_SPc 29..250 CDD:238113 91/233 (39%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 90/232 (39%)
Tryp_SPc 42..264 CDD:238113 91/233 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443334
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.