DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and PRSS38

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:263 Identity:85/263 - (32%)
Similarity:122/263 - (46%) Gaps:41/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCL---S 72
            :|:.|.....| |..|.:|:||...|....||||||....||.|||.|.::..:|:||||.   .
Human    43 ISLTGSVACGR-PSMEGKILGGVPAPERKWPWQVSVHYAGLHVCGGSILNEYWVLSAAHCFHRDK 106

  Fly    73 NVTVTD-------LSVRAGSSYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGT 130
            |:.:.|       |.|....:.|      .:|.:.|.||.|  ::|:|....|.:::...|:..:
Human   107 NIKIYDMYVGLVNLRVAGNHTQW------YEVNRVILHPTY--EMYHPIGGDVALVQLKTRIVFS 163

  Fly   131 VKKIPLAEQTPVAGTIVLTS------GWGYTR---ENSSFLWPILQGVHVAILNRTDCLKAYKHV 186
            ...:|:...||   .:.|||      |||...   |.|.    .||.:.:.::....|...|.|:
Human   164 ESVLPVCLATP---EVNLTSANCWATGWGLVSKQGETSD----ELQEMQLPLILEPWCHLLYGHM 221

  Fly   187 N-ITIDMICADG--QRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGT--NPGVYEDIAFFH 246
            : |..||:||..  .....|:|||||||:........| ||:||||.||..  .||||..:::|.
Human   222 SYIMPDMLCAGDILNAKTVCEGDSGGPLVCEFNRSWLQ-IGIVSWGRGCSNPLYPGVYASVSYFS 285

  Fly   247 NWI 249
            .||
Human   286 KWI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 78/244 (32%)
Tryp_SPc 29..250 CDD:238113 80/245 (33%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 80/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.