DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and Ser12

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster


Alignment Length:258 Identity:103/258 - (39%)
Similarity:137/258 - (53%) Gaps:21/258 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLSILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAH 69
            :||..||.:|.:...:....| ||||||..:.|..||||.::..:..:.||.|||||:.|:||||
  Fly     1 MLLHWLVLVASVTLISAGSSP-ERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAH 64

  Fly    70 CLSNVTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKYVPK--LYNPYDIAVLILEAPLRLGGTVK 132
            |:.....|..|||.||.:.:.|||..:|.....|..||..  |:|  ||||:.|...|.....|:
  Fly    65 CVERPFDTLYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFN--DIAVIRLVDTLIFNAEVR 127

  Fly   133 KIPLAEQTPVAGTIVLTSGWGYTRENSSFLW---PILQGVHVAILNRTDCLKAYKHVNITIDMIC 194
            .|.||:..|.|||....||||    ....||   ..|....|.||:...|.::|::  ||..|||
  Fly   128 PIQLADSAPAAGTEASVSGWG----EIGILWLQPTSLLKTSVKILDPNVCKRSYQY--ITKTMIC 186

  Fly   195 ADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGTN--PGVYEDIAFFHNWIKYTVKK 255
            |.....|:|.|||||||:   .||  ||:|:||:|.||...  ||||.::|....||...:::
  Fly   187 AAALLKDSCHGDSGGPLV---SGG--QLVGIVSYGIGCANPFFPGVYANVAELKPWILNAIEQ 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 94/227 (41%)
Tryp_SPc 29..250 CDD:238113 94/227 (41%)
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 94/227 (41%)
Tryp_SPc 24..238 CDD:238113 93/226 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443138
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104239at33392
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.