DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and Ser6

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:272 Identity:89/272 - (32%)
Similarity:125/272 - (45%) Gaps:49/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCLRLLLSIL-VSIAGLACAARIPGP-EERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRA 63
            :|..||..:| |..|        ||. ..|:|||........|.|||::|...|.|||.|.:...
  Fly    10 LCSFLLFLVLPVQSA--------PGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILTRTY 66

  Fly    64 ILTAAHCLSNVTVTDL---------SVRAGSSYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVL 119
            |||||||:||..|..:         ::||||:....||.:::|.:.|.|.:|...|   .|:|:|
  Fly    67 ILTAAHCVSNEDVNHVITPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFL---NDVALL 128

  Fly   120 ILEAPLRLGGTVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYK 184
            .||:||.|..:::.|.|......|...|:.||||..:.... |...||...:..:.|..|.:   
  Fly   129 RLESPLILSASIQPIDLPTVDTPADVDVVISGWGRIKHQGD-LPRYLQYNTLKSITRQQCEE--- 189

  Fly   185 HVNITIDM-----IC----ADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSW-GDGCG-TNPGV 238
                .||.     :|    .|.   ..|.||||||.:.     :.||:|:..: .|||| |.|..
  Fly   190 ----LIDFGFEGELCLLHQVDN---GACNGDSGGPAVY-----NNQLVGVAGFVVDGCGSTYPDG 242

  Fly   239 YEDIAFFHNWIK 250
            |..:.:|.:|||
  Fly   243 YARVFYFKDWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 78/240 (33%)
Tryp_SPc 29..250 CDD:238113 78/240 (33%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 78/240 (33%)
Tryp_SPc 32..256 CDD:238113 80/242 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.