DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and Np

DIOPT Version :10

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_061514435.1 Gene:Np / 3291870 VectorBaseID:AGAMI1_007541 Length:1276 Species:Anopheles gambiae


Alignment Length:171 Identity:40/171 - (23%)
Similarity:67/171 - (39%) Gaps:39/171 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  1690 LQQFKNIQQKPIAESMNIYQPLLHSIFMFFASKSLGKHLTIVSIKNIIAVLLGLMADNRLVTGTD 1754
            |::..|.|::.|   :|:...::.:|..|...      ||.:|..||....|..|....:..|.|
Mosquito   247 LRRAGNSQRRAI---LNLPSAIVSTITQFLLD------LTGISDANIPYDQLDPMTPLSISLGED 302

  Fly  1755 DAQFVKVVNGICLKILDRTNFTYMNCALIRLLKESCQTSCLPKFTDLQMKCIWRNVKVIPDRLAE 1819
            ::..|:.....| ::.|         .|.|..:::. |.||.:..::.. |:...:.:.|.|..|
Mosquito   303 ESMRVQRYEEAC-RLKD---------PLTRFFRDAI-TDCLNELREMPF-CLNTGILLSPLRGRE 355

  Fly  1820 --------LDYEAVLLEVHDFMLTLPSTWWQTRPSDMPLRT 1852
                    .|||..|...||    |||      .::|..||
Mosquito   356 QGTSCVTWKDYEGFLKREHD----LPS------EANMKKRT 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473
NpXP_061514435.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.