DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and CG9672

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster


Alignment Length:273 Identity:71/273 - (26%)
Similarity:120/273 - (43%) Gaps:38/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCLRLLLSILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAIL 65
            |.|.|.:.:::..||:..|.    |:.||.||....:..:|:|.::.....:.||.||...|..|
  Fly     1 MKLTLTIGLILVAAGVLEAQ----PQGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYAL 61

  Fly    66 TAAHCLSN-------------VTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIA 117
            ||..|:.:             |||..:.:        ..|:.::|.:...:|.|...   ...||
  Fly    62 TALSCVCSDGKDTPWAAVLFAVTVGSVDL--------YNGKQIRVEEITINPNYSTL---KTGIA 115

  Fly   118 VLILEAPLRLGGTVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKA 182
            :|.|:..:....||..|||::..|..|:.|..||||.|.|:...:...||.....::...:|..|
  Fly   116 LLRLQEEITFSETVNAIPLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALA 180

  Fly   183 YKHVNITID--MIC-ADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVS--WGDGCGTNPGVYEDI 242
            .:...:..|  ::| ..|:|...|.||.|||.:.     ..||:|:.:  .|:..|..|..:..|
  Fly   181 NRDELLVADDQVLCLGHGRRQGICSGDIGGPAVY-----QGQLVGLGAQILGECGGMLPERFISI 240

  Fly   243 AFFHNWIKYTVKK 255
            |..::||:..:::
  Fly   241 AANYDWIQQQLQQ 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 62/238 (26%)
Tryp_SPc 29..250 CDD:238113 62/238 (26%)
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 62/238 (26%)
Tryp_SPc 25..250 CDD:238113 63/240 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.