DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and CG4653

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:259 Identity:78/259 - (30%)
Similarity:122/259 - (47%) Gaps:33/259 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RLLLSILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAA 68
            ||||.:::...|:..::|:|..    ||..       |..:|::.|.:|.|||.:..::.|||||
  Fly    11 RLLLLVVIVTLGVVQSSRLPAE----VGSQ-------PHSISLRRNGVHVCGGALIREKWILTAA 64

  Fly    69 HCLS------NVTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKYVPK-LYNPYDIAVLILEAPLR 126
            ||:|      :......:||.||.....|||::.:.|.|.|..|... .....|:|:|.||..:.
  Fly    65 HCVSLGGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVV 129

  Fly   127 LGGTVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDC-LKAYKHVNITI 190
            |......|.||.:.|.||:.::.||||.::.:.| |..:||......|:.:|| .:.|....   
  Fly   130 LNANTNPIDLATERPAAGSQIIFSGWGSSQVDGS-LSHVLQVATRQSLSASDCQTELYLQQE--- 190

  Fly   191 DMIC---ADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVS-WGDGCGT-NPGVYEDIAFFHNWI 249
            |::|   .|......|.||:|.|     ...:.||:|:.: :..|||: .|..|.|:.....||
  Fly   191 DLLCLSPVDEDFAGLCSGDAGAP-----ASYNNQLVGIAAFFVSGCGSEQPDGYVDVTQHLEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 69/233 (30%)
Tryp_SPc 29..250 CDD:238113 71/234 (30%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 72/240 (30%)
Tryp_SPc 30..249 CDD:214473 70/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.