DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and sphe

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:260 Identity:75/260 - (28%)
Similarity:121/260 - (46%) Gaps:32/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RLLLSILVSIAGLA-CAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTA 67
            ||::..|:.:..:. |.|     :.||:||.........:..|::.::.|.|||.|.|...|||.
  Fly     5 RLVILGLIGLTAVGMCHA-----QGRIMGGEDADATATTFTASLRVDNAHVCGGSILSQTKILTT 64

  Fly    68 AHCLSN----VTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKYVPKLYN-PYDIAVLILEAPLRL 127
            |||:..    :..:.|:.|.||:....||:::.|.....||.|    || ..::||:.|.:.|..
  Fly    65 AHCVHRDGKLIDASRLACRVGSTNQYAGGKIVNVESVAVHPDY----YNLNNNLAVITLSSELTY 125

  Fly   128 GGTVKKIPL---AEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYK-HVNI 188
            ...:..|||   .|..|..|:.|:.:|||.|.:.:: .:.|.| :.:.:.....||.||. |.. 
  Fly   126 TDRITAIPLVASGEALPAEGSEVIVAGWGRTSDGTN-SYKIRQ-ISLKVAPEATCLDAYSDHDE- 187

  Fly   189 TIDMIC-ADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDG-CGTN-PGVYEDIAFFHNWIK 250
              ...| |...:..||.||.||..|.     ...|||:.::..| ||:. |.|:..::.:.:||:
  Fly   188 --QSFCLAHELKEGTCHGDGGGGAIY-----GNTLIGLTNFVVGACGSRYPDVFVRLSSYADWIQ 245

  Fly   251  250
              Fly   246  245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 68/232 (29%)
Tryp_SPc 29..250 CDD:238113 68/232 (29%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 66/218 (30%)
Tryp_SPc 42..244 CDD:214473 64/215 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.