DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and CG33159

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_788455.1 Gene:CG33159 / 318901 FlyBaseID:FBgn0053159 Length:257 Species:Drosophila melanogaster


Alignment Length:258 Identity:85/258 - (32%)
Similarity:129/258 - (50%) Gaps:16/258 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCL 71
            |.:|..:..||........:.|||||....|..||:.|.::.|....|||.:.|.||:|:||||:
  Fly     4 LRLLWWLCHLALVLPSSSSKTRIVGGKETTISEVPYLVYLRQNGYFICGGSLISSRAVLSAAHCV 68

  Fly    72 SNVTVTDLSVRAGSSYWSKGGQVLK-VLKTIAHPKYVPKLYNPYDIAVLIL-EAPLRLGGTVKKI 134
            ........:|.||:|...:...|:: |:.....|.|....:: .|:|:|.| |..:...|.|..|
  Fly    69 YGSQPEGFTVHAGASRLDQEAPVVRNVVMFHTSPSYSATNFD-MDVALLQLQEVVVLTPGKVATI 132

  Fly   135 PLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYK-HVNITIDMICA--D 196
            ......|........||||.||||:......::...|.:|...:|..:|. :..::..|:||  .
  Fly   133 SPCRNPPEGNAYARISGWGVTRENNREPAEQVRTTMVRVLPGAECKISYSGYGQLSDSMLCAAVR 197

  Fly   197 GQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCG--TNPGVYEDIAF--FHNWIKYTVKK 255
            |.| |:|.|||||||:  .:|   |:.|:||||.||.  :.||||.::|.  .|.:|:.|:::
  Fly   198 GLR-DSCSGDSGGPLV--YRG---QVCGIVSWGFGCARPSFPGVYTNVASERVHEFIEQTLRR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 79/229 (34%)
Tryp_SPc 29..250 CDD:238113 78/229 (34%)
CG33159NP_788455.1 Tryp_SPc 25..241 CDD:214473 77/222 (35%)
Tryp_SPc 26..251 CDD:238113 79/231 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D114140at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.