DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and CG31269

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:274 Identity:91/274 - (33%)
Similarity:141/274 - (51%) Gaps:37/274 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLSILVSIAGLA--CAARIPG--------PEERIVGGSYIPIEYVPWQVSVQN-NSLHCCGGVI 58
            ::|.||:.::||.  .|.||.|        .::||:||......:.|:|:|:|. :..|.|||.|
  Fly     4 VVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAI 68

  Fly    59 YSDRAILTAAHCLSNVTVTDLSVRAGSS-YWSKGGQVLKVLKTI-AHPKY-VPKLYNPYDIAVLI 120
            .::..:||||||:.|..:..|.|..|:: |...||:..  ||.| .|..| .|:::|  |||:|.
  Fly    69 INETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYF--LKAIHIHCNYDNPEMHN--DIALLE 129

  Fly   121 LEAPLRLGGTVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLW---PI-LQGVHVAILNRTDCLK 181
            |..|:......:.|||.......|..|:.:|||     |:.||   || ||.:::..:...:| |
  Fly   130 LVEPIAWDERTQPIPLPLVPMQPGDEVILTGWG-----STVLWGTSPIDLQVLYLQYVPHREC-K 188

  Fly   182 AYKHVNITIDM--ICADGQRWD-TCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGTN-PGVYEDI 242
            |....:...|:  ||...:..: .|.|||||||:   ..|:  |:|:|:||..|.|. |.|:..:
  Fly   189 ALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLV---SNGY--LVGLVNWGWPCATGVPDVHASV 248

  Fly   243 AFFHNWIKYTVKKN 256
            .|:.:||:..:..|
  Fly   249 YFYRDWIRNVMSGN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 79/232 (34%)
Tryp_SPc 29..250 CDD:238113 79/232 (34%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 79/232 (34%)
Tryp_SPc 38..258 CDD:238113 80/234 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.