DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and CG31267

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:264 Identity:75/264 - (28%)
Similarity:125/264 - (47%) Gaps:23/264 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLLSILVSIAGLACAARIPGPEE-------RIVGGSYIPIEYVPWQVSVQN-NSLHCCGGVIYSD 61
            :||::..|.|.|...|......|       |||||....:...|:.||:|| ...|.|.|.|..|
  Fly    14 VLLALSFSEASLRRRAFTSEKSETANKFSSRIVGGEESDVLAAPYLVSLQNAYGNHFCAGSIIHD 78

  Fly    62 RAILTAAHCLSNVTVTDLSVRAGS-SYWSKGGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPL 125
            :.::|||.||:.:...::.|...: ::|...|.:..|...:.|..:...:|: .|||::...|..
  Fly    79 QWVITAASCLAGLRKNNVQVVTTTYNHWGSEGWIYSVEDIVMHCNFDSPMYH-NDIALIKTHALF 142

  Fly   126 RLGGTVKKI---PLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHV- 186
            ......:.|   ||.:.|.  |..:...|:|.|.....|.|. ||.:.|..:....|...|... 
  Fly   143 DYDDVTQNITIAPLEDLTD--GETLTMYGYGSTEIGGDFSWQ-LQQLDVTYVAPEKCNATYGGTP 204

  Fly   187 NITIDMICADGQ-RWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGTN-PGVYEDIAFFHNWI 249
            ::.:..:||.|: ....|.||:|||::: ::|   :|:|:.:||..||.. |.|:..|:|:::||
  Fly   205 DLDVGHLCAVGKVGAGACHGDTGGPIVD-SRG---RLVGVGNWGVPCGYGFPDVFARISFYYSWI 265

  Fly   250 KYTV 253
            ..|:
  Fly   266 ISTI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 65/228 (29%)
Tryp_SPc 29..250 CDD:238113 65/228 (29%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 65/228 (29%)
Tryp_SPc 45..268 CDD:238113 66/230 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.