DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and CG32834

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:270 Identity:82/270 - (30%)
Similarity:124/270 - (45%) Gaps:47/270 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LRLLLSILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTA 67
            |.||.::|..:.|...|      :.||:||..:.||..|:|..|..:....|.|.|.:...|:||
  Fly     7 LFLLAALLRPVRGDLDA------QSRIIGGYDVDIEDAPYQAEVIIDGTAICSGAIITSDTIITA 65

  Fly    68 AHCLSNVTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKYVPKLYNPY----DIAVLILEAPLRLG 128
            |.|:.:....::.|...|..:...|.:|:|.:.|.||:     ||.:    ::|:|.|..||:..
  Fly    66 ASCVQSYGSIEVRVGTSSRDYDGTGFLLEVCEIINHPQ-----YNCWRFDNNLALLKLCDPLKTS 125

  Fly   129 GTVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLW--------PILQGVHVAILNRTDCLKAYKH 185
            ..::.|.:||..|..|:....||||.|....|: |        ..||...|::.||..| .|.:.
  Fly   126 EAIQPISIAEDEPDDGSWCTVSGWGSTSWWGSW-WDRCFGSLPDYLQMAWVSVYNREQC-AADRG 188

  Fly   186 V-------NITIDMIC----ADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGTNPGVY 239
            |       .|:...:|    |.|     |..|:|.||:  ..|   ||:|::|.| ||.|.|.||
  Fly   189 VWFGLWDNGISYLTLCTHNGAGG-----CSYDTGAPLV--IDG---QLVGILSEG-GCTTKPDVY 242

  Fly   240 EDIAFFHNWI 249
            .::.:|..||
  Fly   243 ANVPWFTGWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 74/243 (30%)
Tryp_SPc 29..250 CDD:238113 75/244 (31%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 74/243 (30%)
Tryp_SPc 27..255 CDD:238113 75/244 (31%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.