DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and CG32808

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:278 Identity:83/278 - (29%)
Similarity:129/278 - (46%) Gaps:42/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSILVSIAGLA-------CAARIPGPEERIVGGSYI-PIEYVPWQVSVQ--NNSLHCCGGVIYSD 61
            ::::..:|.||       ..|...|.:.:||.|:.. |.|: |:.||::  .:..|.||..:.:.
  Fly     1 MAVMAWLARLALFYTATFLLAGASGEDGKIVNGTTAGPGEF-PFVVSLRRAKSGRHSCGATLLNP 64

  Fly    62 RAILTAAHCLSNVTVTDLSVRAGSSYWSK-GGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPL 125
            ..:||||||:...:...|.::.||...:: ..||.:|.....||.|.|:.....|||:|.|...:
  Fly    65 YWVLTAAHCVRGSSPEQLDLQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSV 129

  Fly   126 RLGGTVKKIPLAEQ---TPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCL---KAYK 184
            .|...|:.:.|.|.   ||...:.|| :||| .......:...||.|.:.:.:.|:|.   :.|.
  Fly   130 ALSKFVQPVRLPEPRQVTPGNASAVL-AGWG-LNATGGVVQQHLQKVKLQVFSDTECSERHQTYL 192

  Fly   185 HVNITIDMICA------DGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWG-DGCGTN--PGVYE 240
            |.:    .|||      .||    |.|||||||:..   |....:|:|||. ..|...  |||:.
  Fly   193 HDS----QICAGLPEGGKGQ----CSGDSGGPLLLI---GSDTQVGIVSWSIKPCARPPFPGVFT 246

  Fly   241 DIAFFHNWIKYTVKKNIY 258
            :::.:.:||..||  |.|
  Fly   247 EVSAYVDWIVETV--NSY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 72/239 (30%)
Tryp_SPc 29..250 CDD:238113 73/239 (31%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 72/239 (30%)
Tryp_SPc 30..258 CDD:238113 74/241 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104239at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.