DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and CG6041

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:281 Identity:92/281 - (32%)
Similarity:135/281 - (48%) Gaps:40/281 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCLRLLLSILVSIAGLA--CAARIPGPEERIVGGSYIPIEYVPWQVSVQ--------NNSLHCCG 55
            :.:.|.|..|.|...|:  .|.:|   |.:||||....||.|.:|||::        ..|.|.||
  Fly     8 LAIALFLGALASGESLSSETAGKI---EPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCG 69

  Fly    56 GVIYSDRAILTAAHCL------SNVTVTDLSVRAGSSYWSKGGQ---VLKVLKTIAHPKYVP-KL 110
            ||:.|.|.:.|||||.      ...|..:..:..||:|.:....   :..:.:.|.|..|.| .|
  Fly    70 GVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDAL 134

  Fly   111 YNPYDIAVLILEAPLRLG-GTVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAIL 174
            .|  |||::.:...:... .||..:.|..|.....|..|.||||..::|.:|....||...|.|:
  Fly   135 TN--DIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIV 197

  Fly   175 NRTDCLKAYKHVNITIDMICAD--GQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGT--N 235
            :.|.|..:|.  :|.:..:||.  ....|.||||||||:  :..|   .|.|:||:|.||..  .
  Fly   198 SYTTCRISYN--SIPVSQVCAGYLSGGVDACQGDSGGPM--SCNG---MLAGIVSYGAGCAAPGY 255

  Fly   236 PGVYEDIAFFHNWIKYTVKKN 256
            ||||.:::::::||   |:||
  Fly   256 PGVYTNVSYYYDWI---VQKN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 79/243 (33%)
Tryp_SPc 29..250 CDD:238113 80/243 (33%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 79/243 (33%)
Tryp_SPc 35..272 CDD:238113 82/248 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27101
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.