DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and Prtn3

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:276 Identity:70/276 - (25%)
Similarity:106/276 - (38%) Gaps:71/276 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CLRLLLSILVSIAGLACAARIPGPEE--RIVGGSYIPIEYVPWQVSVQ---NNSLHCCGGVIYSD 61
            ||||        ||:    |..|..:  :||||........|:..|:|   :...|.|||.:...
  Rat   181 CLRL--------AGV----RFHGAVQASKIVGGHEARPHSRPYVASLQLSRSPGSHFCGGTLIHP 233

  Fly    62 RAILTAAHCLSNVTVTDLSVRAGS-SYWSKGGQVLKVLKTIAHPKYVPKLYNP----YDIAVLIL 121
            |.:|||||||.:::...::|..|: ...|...:..|...|    :.....|||    .|:.:|.|
  Rat   234 RFVLTAAHCLQDISWQLVTVVLGAHDLLSSEPEQQKFTIT----QVFENNYNPEETLNDVLLLQL 294

  Fly   122 EAPLRLGG--TVKKIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYK 184
            ..|..||.  .|..:|..:|:...||..|..|||                  .:..|....:...
  Rat   295 NRPASLGKQVAVASLPQQDQSLSQGTQCLAMGWG------------------RLGTRAPTPRVLH 341

  Fly   185 HVNIT-IDMICAD--------GQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDG-----CGT- 234
            .:|:| :..:|.:        .:....|.||||||||         ..|::...|.     |.: 
  Rat   342 ELNVTVVTFLCREHNVCTLVPRRAAGICFGDSGGPLI---------CNGILHGVDSFVIRECASL 397

  Fly   235 -NPGVYEDIAFFHNWI 249
             .|..:..::.:.|||
  Rat   398 QFPDFFARVSMYVNWI 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 60/246 (24%)
Tryp_SPc 29..250 CDD:238113 62/247 (25%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 62/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.