DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and Elane

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:260 Identity:63/260 - (24%)
Similarity:107/260 - (41%) Gaps:30/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLSILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHC 70
            |.|:|:::. |.|    |.....||||........|:.||:|....|.||..:.:...:::||||
  Rat    15 LASMLLALL-LVC----PALASEIVGGRPAQPHAWPFMVSLQRRGGHFCGATLIARNFVMSAAHC 74

  Fly    71 LSNVTVTDLSVRAGSSYWSK---GGQVLKVLKTIAHPKYVPKLYNPYDIAVLILEAPLRLGGTVK 132
            ::......:.|..|:....:   ..|:..|.:...:.....:|.|  ||.::.|.....:...|:
  Rat    75 VNGRNFQSVQVVLGAHDLRRREPTRQIFSVQRIFENGFDPSRLLN--DIVIIQLNGSATINANVQ 137

  Fly   133 KIPLAEQTPVAG--TIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHVNITIDMIC- 194
            ...|..|....|  |..:..|||....|.. |..:||.::|.::...    ..:.||     :| 
  Rat   138 VAELPAQGQGVGNRTPCVAMGWGRLGTNRP-LPSVLQELNVTVVTNL----CRRRVN-----VCT 192

  Fly   195 -ADGQRWDTCQGDSGGPLI--ETTKGGHRQLIGMVSWGDGCGTNPGVYEDIAFFHNWIKYTVKKN 256
             ...::...|.|||||||:  ...:|    :...:..|.|.|..|..:..:|.|.:||...::.:
  Rat   193 LVPRRQAGICFGDSGGPLVCNNLVQG----IDSFIRGGCGSGFYPDAFAPVAEFADWINSIIRSH 253

  Fly   257  256
              Rat   254  253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 55/229 (24%)
Tryp_SPc 29..250 CDD:238113 56/229 (24%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 55/229 (24%)
Tryp_SPc 33..249 CDD:238113 57/231 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.