DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and Klk10

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001004100.1 Gene:Klk10 / 292850 RGDID:1303242 Length:279 Species:Rattus norvegicus


Alignment Length:275 Identity:87/275 - (31%)
Similarity:124/275 - (45%) Gaps:38/275 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LRLLLSILVSIAGLACAARIPG---PEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAI 64
            ::|||.:|:.....|.|..:||   .|:....|:..|....|||||:.:|....|.||:.....:
  Rat    18 VKLLLPLLMMQLWAAQALLLPGNTTREDLEAFGTLCPSVSQPWQVSLFHNLQFQCAGVLVDQNWV 82

  Fly    65 LTAAHCLSNVTVTDLSVRAGSSY--WSKGGQVLKVLKTIAHPKY-------VPKLYNPYDIAVLI 120
            ||||||..|   ..|..|.|..:  ..:..|:......:.||||       :|...:.:|:.:|.
  Rat    83 LTAAHCWRN---KPLRARVGDDHLLLFQSEQLRSTNSPVFHPKYQPCSGPVLPLRSDEHDLMMLK 144

  Fly   121 LEAPLRLGGTVKKIPLAEQTPVAGTIVLTSGWGYT-----RENSSFLWPILQGVHVAILNRTDCL 180
            |.:|:.|...|..:.|..|..........||||.|     :.|.|     |....|.:|::..|.
  Rat   145 LSSPVVLTSKVHPVQLPFQCAQPRQECQVSGWGTTANRRVKYNRS-----LSCSRVTLLSQKQCE 204

  Fly   181 KAYKHVNITIDMICADGQR-WDTCQGDSGGPLI-ETTKGGHRQLIGMVSWG-DGCGT---NPGVY 239
            ..|..| ||.:||||...| .|:||.||||||: :.|      |.|::||. ..||.   .|.||
  Rat   205 TFYPGV-ITNNMICAGMDRDQDSCQSDSGGPLVCDNT------LHGILSWSIYPCGAATQYPAVY 262

  Fly   240 EDIAFFHNWIKYTVK 254
            ..|..:.|||:..::
  Rat   263 AKICNYTNWIRRVIR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 76/240 (32%)
Tryp_SPc 29..250 CDD:238113 77/240 (32%)
Klk10NP_001004100.1 Tryp_SPc 50..272 CDD:214473 76/236 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.