DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and Prss38

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:257 Identity:71/257 - (27%)
Similarity:120/257 - (46%) Gaps:28/257 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNSLHCCGGVIYSDRAILTAAHCLSN------- 73
            |:.|...|....:::||........|||||:.....|.|||.|.:...:||||||.:.       
  Rat   101 LSSACGQPALHGKLLGGELTIDRKWPWQVSIHYAGFHVCGGSILNAYWVLTAAHCFAREKRLQTF 165

  Fly    74 ---VTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKYVPKLYNPY--DIAVLILEAPLRLGGTVKK 133
               |.:|:|.|....:.|.:..||      |.||.:  ::::|.  |:|::..::.:.....|..
  Rat   166 DMYVGITNLEVANKHTQWFEINQV------IIHPTF--EMFHPVGGDVALVQSKSAIVFSDYVLP 222

  Fly   134 IPL-AEQTPVAGTIVLTSGWGYTRENSSFLWPILQGVHVAILNRTDCLKAYKHVNITI-DMICAD 196
            |.| :....::.....|:|||...........:|: ..:.::.:..|...|...:..: :|:||.
  Rat   223 ICLPSSNLNLSDLSCWTTGWGMVSPQGETGKDLLE-AQLPLIPKFQCQLLYGLTSYLLPEMLCAG 286

  Fly   197 G--QRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCG--TNPGVYEDIAFFHNWIKYTVK 254
            .  ...:.|:||||.||:........| ||:||||.||.  ..|||:.::::|.|||:|.::
  Rat   287 DIKNMKNVCEGDSGSPLVCKVNQTWLQ-IGIVSWGRGCAQPLYPGVFANVSYFLNWIRYNME 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 65/238 (27%)
Tryp_SPc 29..250 CDD:238113 66/238 (28%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 66/236 (28%)
Tryp_SPc 116..342 CDD:214473 65/235 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.