DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31681 and Prss34

DIOPT Version :9

Sequence 1:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:282 Identity:94/282 - (33%)
Similarity:136/282 - (48%) Gaps:28/282 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCLRLLLSILVSIAGLACAARI---PGPE-ERIVGGSYIPIEYVPWQVSVQ--NNSL----HCCG 55
            |||.:|..:.:::..|.....:   .|.| ..||||..:.....|||||::  |..|    |.||
  Rat     1 MCLGMLWFLFLTLPCLGSTMPLTPDSGQELVGIVGGCPVSASRFPWQVSLRFYNMKLSKWEHICG 65

  Fly    56 GVIYSDRAILTAAHC--LSNVTVTDLSVRAGSSYWSKGGQVLKVLKTIAHPKYVPKLYNP--YDI 116
            |.:...:.:||||||  |..:..:...|:.|.....:..|::||.|.|.|||:..||..|  .||
  Rat    66 GSLIHPQWVLTAAHCVELKEMEASCFRVQVGQLRLYENDQLMKVAKIIRHPKFSEKLSAPGGADI 130

  Fly   117 AVLILEAPLRLGGTVK--KIPLAEQTPVAGTIVLTSGWGYTRENSSFLWPI-LQGVHVAILNRTD 178
            |:|.|::.:.|...|.  .:|.|.|...:......:|||....:.....|. |:.|.|.|:..:|
  Rat   131 ALLKLDSTVVLSERVHPVSLPAASQRISSKKTWWVAGWGVIEGHRPLPPPCHLREVAVPIVGNSD 195

  Fly   179 CLKAYKHVN--------ITIDMICADGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCGTN 235
            |.:.|:..:        |..||:||..:..|:||.||||||:........| :|:||||.|||..
  Rat   196 CEQKYRTYSSLDRTTKIIKDDMLCAGMEGRDSCQADSGGPLVCRWNCSWVQ-VGVVSWGIGCGLP 259

  Fly   236 --PGVYEDIAFFHNWIKYTVKK 255
              ||||..:..:.:||...|.|
  Rat   260 DFPGVYTRVMSYLSWIHGYVPK 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 83/243 (34%)
Tryp_SPc 29..250 CDD:238113 84/243 (35%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 84/243 (35%)
Tryp_SPc 33..275 CDD:214473 83/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.